PDB entry 1b7x

View 1b7x on RCSB PDB site
Description: structure of human alpha-thrombin y225i mutant bound to d-phe-pro-arg-chloromethylketone
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, hydrolase/hydrolase inhibitor complex
Deposited on 1999-01-25, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thrombin light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7x.1
  • Chain 'B':
    Compound: protein (thrombin heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered (236)
    Domains in SCOPe 2.07: d1b7x.1
  • Chain 'C':
    Compound: protein (inhibitor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1B7X (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b7xA (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7xA (A:)
    adcglrplfekksledkterellesy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b7xB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkigfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7xB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpd
    retaasllqagykgrvtgwgnlkegqpsvlqvvnlpiverpvckdstriritdnmfcagy
    kpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkigfythvfrlkkwi
    qkvidq
    

  • Chain 'C':
    No sequence available.