PDB entry 1b7v

View 1b7v on RCSB PDB site
Description: structure of the c-553 cytochrome from bacillus pasteruii to 1.7 a resolution
Deposited on 1999-01-22, released 2000-03-27
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1b7va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b7vA (A:)
  vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
  eavaawlaekk