PDB entry 1b7v

View 1b7v on RCSB PDB site
Description: Structure of the C-553 cytochrome from Bacillus pasteruii to 1.7 A resolution
Class: electron transfer
Keywords: cytochrome, electron transfer
Deposited on 1999-01-22, released 2000-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cytochrome c-553)
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82599 (0-70)
  Domains in SCOPe 2.08: d1b7va_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b7vA (A:)
  vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
  eavaawlaekk