PDB entry 1b7u

View 1b7u on RCSB PDB site
Description: Structure of Mare Apolactoferrin: the N and C Lobes are in the Closed Form
Class: metal binding protein
Keywords: apolactoferrin, binding site, metal binding protein
Deposited on 1999-01-01, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.2
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (apolactoferrin)
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77811 (0-688)
      • (222)
      • (268)
      • (289)
      • (293-295)
    Domains in SCOPe 2.07: d1b7ua1, d1b7ua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7uA (A:)
    aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
    gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
    rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
    cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
    afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
    kdsalgfvripsqidsglylganyltatqnlretaaevaarrervvwcavgpeeerkckq
    wsdvsnrkvacasastteecialvlkgeadalnldggfiyvagkcglvpvlaenqksqns
    napdcvhrppegylavavvrksdadltwnslsgkkschtgvgrtaawnipmgllfnqtgs
    ckfdkffsqscapgadpqsslcalcvgnnenenkcmpnseeryygytgafrclaekagdv
    afvkdvtvlqntdgknsepwakdlkqedfellcldgtrkpvaeaeschlarapnhavvsq
    sdraqhlkkvlflqqdqfggngpdcpgkfclfksetknllfndnteclaelqgkttyeqy
    lgseyvtsitnlrrcsssplleacaflra