PDB entry 1b7t

View 1b7t on RCSB PDB site
Description: myosin digested by papain
Class: myosin
Keywords: myosin motor
Deposited on 1999-01-15, released 1999-05-12
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b7ta1, d1b7ta4
  • Chain 'Y':
    Compound: myosin regulatory light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b7ty_
  • Chain 'Z':
    Compound: myosin essential light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b7tz_
  • Heterogens: MG, CA, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b7tA (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7tA (A:)
    fsdpdfqylavdafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddi
    qsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrrlpiytd
    sviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkkvimyla
    kvacaegsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkiagadietyl
    leksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcltvdniddve
    efklcdeafdilgftkeekqsmfkctasilhmgemkfkqaesdgtaeaekvaflcginag
    dllkallkpkvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvl
    diagfeifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmc
    idliekpmgilsileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfe
    lhhyagnvpysitgwleknkdpinenvvallgaskeplvaelfkaqtisavhreslnklm
    knlysthphfvrciipnelkqpglvdaelvlhqlqcngrkgfpsrliysefkqrysilap
    naipdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiismfqahi
    rgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1b7tY (Y:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7tY (Y:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1b7tZ (Z:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7tZ (Z:)
    klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
    vdeiikltdlqedlegnvkyedfvkkvmagpyp