PDB entry 1b7t

View 1b7t on RCSB PDB site
Description: myosin digested by papain
Deposited on 1999-01-15, released 1999-05-12
The last revision prior to the SCOP 1.57 freeze date was dated 1999-05-12, with a file datestamp of 1999-05-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b7tA (A:)
    fsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivads
    strtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavn
    pyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkte
    ntkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnnssrfg
    kfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtp
    dsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfk
    qrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvg
    alakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerl
    qqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkadd
    ksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpine
    nvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknlysth
    phfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqrysila
    pnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiism
    fqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7tA (A:)
    fsdpdfqylavdafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddi
    qsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrrlpiytd
    sviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkkvimyla
    kvacaegsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkiagadietyl
    leksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcltvdniddve
    efklcdeafdilgftkeekqsmfkctasilhmgemkfkqaesdgtaeaekvaflcginag
    dllkallkpkvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtkakrnyyigvl
    diagfeifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawefidfgmdlqmc
    idliekpmgilsileeecmfpkaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfe
    lhhyagnvpysitgwleknkdpinenvvallgaskeplvaelfkaqtisavhreslnklm
    knlysthphfvrciipnelkqpglvdaelvlhqlqcngrkgfpsrliysefkqrysilap
    naipdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlskiismfqahi
    rgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7tY (Y:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikg
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7tZ (Z:)
    klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
    vdeiikltdlqedlegnvkyedfvkkvmagpyp