PDB entry 1b7g

View 1b7g on RCSB PDB site
Description: glyceraldehyde 3-phosphate dehydrogenase
Deposited on 1999-01-22, released 1999-10-08
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-17, with a file datestamp of 2000-04-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7gO (O:)
    mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
    eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
    alcnynealgkkyirvvscnttallrtictvnkvskvekvrativrraadqkevkkgpin
    slvpdpatvpshhakdvnsvirnldiatmaviapttlmhmhfinitlkdkvekkdilsvl
    entprivlisskydaeataelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
    esivvpenidairasmklmsaedsmritneslgilkgyli
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7gQ (Q:)
    mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
    eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
    alcnynealgkkyirvvscnttallrtictvnkvskvekvrativrraadqkevkkgpin
    slvpdpatvpshhakdvnsvirnldiatmaviapttlmhmhfinitlkdkvekkdilsvl
    entprivlisskydaeataelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
    esivvpenidairasmklmsaedsmritneslgilkgyli