PDB entry 1b7g

View 1b7g on RCSB PDB site
Description: glyceraldehyde 3-phosphate dehydrogenase
Class: oxidoreductase
Keywords: archaea; hyperthermophile; gapdh; hyperthermophilic dehydrogenase, oxidoreductase
Deposited on 1999-01-22, released 1999-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: protein (glyceraldehyde 3-phosphate dehydrogenase)
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39460 (0-339)
      • see remark 999 (1)
      • see remark 999 (47)
      • engineered (51)
      • see remark 999 (71-72)
      • see remark 999 (158)
    Domains in SCOPe 2.07: d1b7go1, d1b7go2
  • Chain 'Q':
    Compound: protein (glyceraldehyde 3-phosphate dehydrogenase)
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39460 (0-339)
      • see remark 999 (1)
      • see remark 999 (47)
      • engineered (51)
      • see remark 999 (71-72)
      • see remark 999 (158)
    Domains in SCOPe 2.07: d1b7gq1, d1b7gq2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7gO (O:)
    mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
    eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
    alcnynealgkkyirvvscnttallrtictvnkvskvekvrativrraadqkevkkgpin
    slvpdpatvpshhakdvnsvirnldiatmaviapttlmhmhfinitlkdkvekkdilsvl
    entprivlisskydaeataelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
    esivvpenidairasmklmsaedsmritneslgilkgyli
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7gQ (Q:)
    mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
    eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
    alcnynealgkkyirvvscnttallrtictvnkvskvekvrativrraadqkevkkgpin
    slvpdpatvpshhakdvnsvirnldiatmaviapttlmhmhfinitlkdkvekkdilsvl
    entprivlisskydaeataelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
    esivvpenidairasmklmsaedsmritneslgilkgyli