PDB entry 1b7f

View 1b7f on RCSB PDB site
Description: sxl-lethal protein/RNA complex
Class: RNA-binding protein/RNA
Keywords: SPLICING REGULATION, RNP DOMAIN, RNA COMPLEX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA-BINDING PROTEIN-RNA COMPLEX
Deposited on 1999-01-23, released 1999-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sxl-lethal protein)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19339 (Start-167)
      • engineered (44)
    Domains in SCOPe 2.06: d1b7fa1, d1b7fa2
  • Chain 'B':
    Compound: protein (sxl-lethal protein)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19339 (Start-167)
      • engineered (44)
    Domains in SCOPe 2.06: d1b7fb1, d1b7fb2
  • Chain 'P':
    Compound: RNA (5'-r(p*gp*up*up*gp*up*up*up*up*up*up*up*u)-3')
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: RNA (5'-r(p*gp*up*up*gp*up*up*up*up*up*up*up*u)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b7fA (A:)
    asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqr
    aikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldtifgkygsivqkn
    ilrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7fA (A:)
    sntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqra
    ikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldtifgkygsivqkni
    lrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b7fB (B:)
    asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqr
    aikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldtifgkygsivqkn
    ilrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7fB (B:)
    sntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqra
    ikvlngitvrnkrlkvsyarpggesikdtnlyvtnlprtitddqldtifgkygsivqkni
    lrdkltgrprgvafvrynkreeaqeaisalnnvipeggsqplsvrla
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.