PDB entry 1b7d

View 1b7d on RCSB PDB site
Description: neurotoxin (ts1) from brazilian scorpion tityus serrulatus
Class: toxin
Keywords: long-chain neurotoxin
Deposited on 1999-01-21, released 1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (neurotoxin ts1)
    Species: Tityus serrulatus [TaxId:6887]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b7da_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7dA (A:)
    kegylmdhegcklscfirpsgycgrecgikkgssgycawpacycyglpnwvkvwdratnk
    c