PDB entry 1b7c

View 1b7c on RCSB PDB site
Description: 0.97 a crystal structure of cytochrome c-553 from bacillus pasteurii
Class: electron transport
Keywords: c-553, heme, cytochrome, bacillus pasteurii, cytochrome c-553
Deposited on 1999-01-21, released 2000-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2000-03-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.116
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c-553
  Species: Bacillus pasteurii
  Domains in SCOPe 2.08: d1b7ca_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b7cA (A:)
  vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
  eavaawlaekk