PDB entry 1b7c

View 1b7c on RCSB PDB site
Description: 0.97 a crystal structure of cytochrome c-553 from bacillus pasteurii
Deposited on 1999-01-21, released 2000-01-21
The last revision was dated 2000-03-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.116
AEROSPACI score: 1.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c-553
    Species: Bacillus pasteurii
  • Heterogens: HEM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1b7cA (A:)
    vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
    eavaawlaekk