PDB entry 1b7b

View 1b7b on RCSB PDB site
Description: Carbamate kinase from Enterococcus faecalis
Deposited on 1999-01-20, released 2000-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b7ba_
  • Chain 'B':
    Domains in SCOP 1.55: d1b7bb_
  • Chain 'C':
    Domains in SCOP 1.55: d1b7bc_
  • Chain 'D':
    Domains in SCOP 1.55: d1b7bd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7bA (A:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7bB (B:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7bC (C:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7bD (D:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv