PDB entry 1b7b

View 1b7b on RCSB PDB site
Description: Carbamate kinase from Enterococcus faecalis
Class: transferase
Keywords: phosphotransferase, arginine catabolism, ATP synthesys, acylphosphate-making enzymes, open alpha/beta sheet
Deposited on 1999-01-20, released 2000-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbamate kinase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7ba_
  • Chain 'B':
    Compound: carbamate kinase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7bb_
  • Chain 'C':
    Compound: carbamate kinase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7bc_
  • Chain 'D':
    Compound: carbamate kinase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7bd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b7bA (A:)
    mgkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlll
    qqqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpad
    eafknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlik
    ndiitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygk
    pdekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsg
    deivgtvvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7bA (A:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b7bB (B:)
    mgkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlll
    qqqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpad
    eafknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlik
    ndiitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygk
    pdekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsg
    deivgtvvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7bB (B:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b7bC (C:)
    mgkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlll
    qqqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpad
    eafknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlik
    ndiitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygk
    pdekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsg
    deivgtvvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7bC (C:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b7bD (D:)
    mgkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlll
    qqqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpad
    eafknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlik
    ndiitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygk
    pdekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsg
    deivgtvvtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7bD (D:)
    gkkmvvalggnailsndasahaqqqalvqtsaylvhlikqghrlivshgngpqvgnlllq
    qqaadseknpampldtcvamtqgsigywlsnalnqelnkagikkqvatvltqvvvdpade
    afknptkpigpflteaeakeamqagaifkedagrgwrkvvpspkpidiheaetintlikn
    diitiscggggipvvgqelkgveavidkdfaseklaelvdadalviltgvdyvcinygkp
    dekqltnvtvaeleeykqaghfapgsmlpkieaaiqfvesqpnkqaiitslenlgsmsgd
    eivgtvv