PDB entry 1b7a

View 1b7a on RCSB PDB site
Description: structure of the phosphatidylethanolamine-binding protein from bovine brain
Class: lipid binding protein
Keywords: phospholipid binding protein
Deposited on 1999-01-21, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylethanolamine-binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7aa_
  • Chain 'B':
    Compound: phosphatidylethanolamine-binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7ab_
  • Heterogens: OPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7aA (A:)
    pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg
    klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv
    wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly
    eqlsgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7aB (B:)
    pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg
    klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv
    wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly
    eqlsgk