PDB entry 1b79

View 1b79 on RCSB PDB site
Description: n-terminal domain of DNA replication protein dnab
Class: hydrolase
Keywords: helicase, hexamer, DNA replication, hydrolase
Deposited on 1999-01-28, released 1999-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.263
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DnaB Helicase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b79a_
  • Chain 'B':
    Compound: DnaB Helicase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b79b_
  • Chain 'C':
    Compound: DnaB Helicase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b79c_
  • Chain 'D':
    Compound: DnaB Helicase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b79d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b79A (A:)
    mashmerdpqvaglkvpphsieaeqsvlgglmldnerwddvaervvaddfytrphrhift
    emarlqesgspidlitlaeslerqgqldsvggfaylaelskntpsaanisayadivrer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b79A (A:)
    pphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspidlit
    laeslerqgqldsvggfaylaelskntpsaanisayadivre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b79B (B:)
    mashmerdpqvaglkvpphsieaeqsvlgglmldnerwddvaervvaddfytrphrhift
    emarlqesgspidlitlaeslerqgqldsvggfaylaelskntpsaanisayadivrer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b79B (B:)
    pphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspidlit
    laeslerqgqldsvggfaylaelskntpsaanisayadivrer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b79C (C:)
    mashmerdpqvaglkvpphsieaeqsvlgglmldnerwddvaervvaddfytrphrhift
    emarlqesgspidlitlaeslerqgqldsvggfaylaelskntpsaanisayadivrer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b79C (C:)
    pphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspidlit
    laeslerqgqldsvggfaylaelskntpsaanisayadivre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b79D (D:)
    mashmerdpqvaglkvpphsieaeqsvlgglmldnerwddvaervvaddfytrphrhift
    emarlqesgspidlitlaeslerqgqldsvggfaylaelskntpsaanisayadivrer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b79D (D:)
    pphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspidlit
    laeslerqgqldsvggfaylaelskntpsaanisayadivrer