PDB entry 1b77

View 1b77 on RCSB PDB site
Description: building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from DNA polymerase
Class: sliding clamp
Keywords: sliding clamp, gp45, replisome
Deposited on 1999-01-27, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sliding clamp)
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b77a1, d1b77a2
  • Chain 'B':
    Compound: protein (sliding clamp)
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b77b1, d1b77b2
  • Chain 'C':
    Compound: protein (sliding clamp)
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: GENE 45
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b77c1, d1b77c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b77A (A:)
    mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
    lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfpvasviteika
    edlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltltdydgsnnfnf
    vinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b77B (B:)
    mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
    lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfpvasviteika
    edlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltltdydgsnnfnf
    vinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b77C (C:)
    mklskdtiailknfasinsgillsqgkfimtravngttyaeanisdeidfdvalydlnsf
    lsilslvsddaeismhtdgnikiadtrstvywpaadkstivfpnkpiqfpvasviteika
    edlqqllrvsrglqidtiaitnkdgkivingynkvedsgltrpkysltltdydgsnnfnf
    vinmanmkiqpgnykvmlwgagdkvaakfessqvsyviameadsthdf