PDB entry 1b76

View 1b76 on RCSB PDB site
Description: glycyl-tRNA synthetase from thermus thermophilus complexed with ATP
Class: ligase
Keywords: aminoacyl-tRNA synthase, ligase(synthetase), ligase
Deposited on 1999-01-27, released 1999-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.227
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycyl-tRNA synthetase)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GLYS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56206 (95-441)
      • conflict (90)
      • conflict (92)
    Domains in SCOPe 2.05: d1b76a1, d1b76a2
  • Chain 'B':
    Compound: protein (glycyl-tRNA synthetase)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: GLYS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56206 (95-441)
      • conflict (90)
      • conflict (92)
    Domains in SCOPe 2.05: d1b76b1, d1b76b2
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b76A (A:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
    ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
    vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
    elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
    vdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkar
    llalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrd
    tmeqirlhvdelegflrerlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b76B (B:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnakarywtppryfnmmfqdlrgprggrglla
    ylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyf
    vrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgsl
    elegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsag
    vdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkar
    llalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrd
    tmeqirlhvdelegflrerlrw