PDB entry 1b74

View 1b74 on RCSB PDB site
Description: glutamate racemase from aquifex pyrophilus
Class: isomerase
Keywords: racemase, isomerase
Deposited on 1999-01-27, released 2000-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate racemase
    Species: Aquifex pyrophilus [TaxId:2714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b74a1, d1b74a2
  • Heterogens: DGN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b74A (A:)
    mkigifdsgvggltvlkairnryrkvdivylgdtarvpygirskdtiiryslecagflkd
    kgvdiivvacntasayalerlkkeinvpvfgviepgvkealkksrnkkigvigtpatvks
    gayqrkleeggadvfakacplfaplaeegllegeitrkvvehylkefkgkidtlilgcth
    ypllkkeikkflgdaevvdssealslslhnfikddgssslelfftdlspnlqfliklilg
    rdypvklaegvfth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b74A (A:)
    mkigifdsgvggltvlkairnryrkvdivylgdtarvpygirskdtiiryslecagflkd
    kgvdiivvacntasayalerlkkeinvpvfgviepgvkealkksrnkkigvigtpatvks
    gayqrkleeggadvfakacplfaplaeegllegeitrkvvehylkefkgkidtlilgcth
    ypllkkeikkflgdaevvdssealslslhnfikddgssslelfftdlspnlqfliklilg
    rdypvklaegvf