PDB entry 1b71

View 1b71 on RCSB PDB site
Description: rubrerythrin
Class: electron transport
Keywords: electron transport, iron, ferroxidase
Deposited on 1999-01-26, released 2000-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (rubrerythrin)
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1b71a1, d1b71a2
  • Heterogens: FE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b71A (A:)
mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
fasiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahp
kahfellginw