PDB entry 1b6v

View 1b6v on RCSB PDB site
Description: crystal structure of a hybrid between ribonuclease a and bovine seminal ribonuclease
Deposited on 1999-01-18, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b6va_
  • Chain 'B':
    Domains in SCOP 1.55: d1b6vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6vA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqankhiivacggkpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6vB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqankhiivacggkpyvpvhf
    dasv