PDB entry 1b6v

View 1b6v on RCSB PDB site
Description: crystal structure of a hybrid between ribonuclease a and bovine seminal ribonuclease
Class: molecular evolution
Keywords: molecular evolution, ribonuclease
Deposited on 1999-01-18, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bos taurus, synthetic [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • mutation (54)
      • mutation (61)
      • mutation (63)
      • mutation (75)
      • mutation (79)
      • mutation (110)
      • mutation (112)
    Domains in SCOPe 2.07: d1b6va_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Bos taurus, synthetic [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • mutation (54)
      • mutation (61)
      • mutation (63)
      • mutation (75)
      • mutation (79)
      • mutation (110)
      • mutation (112)
    Domains in SCOPe 2.07: d1b6vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6vA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqankhiivacggkpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6vB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqankhiivacggkpyvpvhf
    dasv