PDB entry 1b6u

View 1b6u on RCSB PDB site
Description: crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles
Class: killer cell inhibitory receptor
Keywords: killer cell inhibitory receptor, natural killer cell, hla, major histocompatibility complex class I (MHC class I), cell surface receptor, immunoglobulin superfamily
Deposited on 1999-01-18, released 1999-01-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p58 killer cell inhibitory receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NKAT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1b6ua1, d1b6ua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6uA (A:)
    hegvhrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvs
    kanfsigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvla
    gesvtlscssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgs
    frdspyewsnssdpllvsvtgnpsnswpsptepssetgnprhlhaaaeqkliseedlnld
    lvprgssshhhhhhssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6uA (A:)
    hrkpsllahpgplvkseetvilqcwsdvrfqhfllhregkfkdtlhligehhdgvskanf
    sigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlagesv
    tlscssrssydmyhlsregeaherrfsagpkvngtfqadfplgpathggtyrcfgsfrds
    pyewsnssdpllvsvtgnp