PDB entry 1b6s

View 1b6s on RCSB PDB site
Description: structure of n5-carboxyaminoimidazole ribonucleotide synthetase
Class: lyase
Keywords: ATP-grasp, carboxyphosphate, purine biosynthesis, lyase
Deposited on 1999-01-18, released 1999-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (n5-carboxyaminoimidazole ribonucleotide synthetase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09029 (0-354)
      • conflict (204)
    Domains in SCOPe 2.07: d1b6sa1, d1b6sa2, d1b6sa3
  • Chain 'B':
    Compound: protein (n5-carboxyaminoimidazole ribonucleotide synthetase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09029 (0-354)
      • conflict (204)
    Domains in SCOPe 2.07: d1b6sb1, d1b6sb2, d1b6sb3
  • Chain 'C':
    Compound: protein (n5-carboxyaminoimidazole ribonucleotide synthetase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09029 (0-354)
      • conflict (204)
    Domains in SCOPe 2.07: d1b6sc1, d1b6sc2, d1b6sc3
  • Chain 'D':
    Compound: protein (n5-carboxyaminoimidazole ribonucleotide synthetase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09029 (0-354)
      • conflict (204)
    Domains in SCOPe 2.07: d1b6sd1, d1b6sd2, d1b6sd3
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6sA (A:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggydgrgqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplt
    hnlhqdgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinela
    prvhnsghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplv
    hlhwydkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6sA (A:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtgggqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlh
    qdgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvh
    nsghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplvhlhw
    ydkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6sB (B:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggydgrgqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplt
    hnlhqdgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinela
    prvhnsghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplv
    hlhwydkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b6sC (C:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggydgrgqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplt
    hnlhqdgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinela
    prvhnsghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplv
    hlhwydkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6sC (C:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhq
    dgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhn
    sghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplvhlhwy
    dkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b6sD (D:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggydgrgqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplt
    hnlhqdgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinela
    prvhnsghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplv
    hlhwydkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6sD (D:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    elarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhq
    dgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhn
    sghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplvhlhwy
    dkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg