PDB entry 1b6r

View 1b6r on RCSB PDB site
Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli
Class: lyase
Keywords: ATP-grasp, carboxyphosphate, purine biosynthesis, lyase
Deposited on 1999-01-17, released 1999-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (n5-carboxyaminoimidazole ribonucleotide synthetase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09029 (0-354)
      • conflict (60)
      • conflict (204)
    Domains in SCOPe 2.07: d1b6ra1, d1b6ra2, d1b6ra3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6rA (A:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    qlarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtggydgrgqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplt
    hnlhqdgilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinela
    prvhnsghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplv
    hlhwydkevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6rA (A:)
    mkqvcvlgngqlgrmlrqageplgiavwpvgldaepaavpfqqsvitaeierwpetaltr
    qlarhpafvnrdvfpiiadrltqkqlfdklhlptapwqllaersewpavfdrlgelaivk
    rrtgqwrlraneteqlpaecygeciveqginfsgevslvgargfdgstvfyplthnlhqd
    gilrtsvafpqanaqqqaraeemlsaimqelgyvgvmamecfvtpqgllinelaprvhns
    ghwtqngasisqfelhlraitdlplpqpvvnnpsvminligsdvnydwlklplvhlhwyd
    kevrpgrkvghlnltdsdtsrltatlealipllppeyasgviwaqskfg