PDB entry 1b6q

View 1b6q on RCSB PDB site
Description: alanine 31 proline mutant of rop protein
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1999-01-16, released 1999-07-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: -1.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-End)
      • engineered mutation (30)
    Domains in SCOPe 2.08: d1b6qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1b6qA (A:)
mtkqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarfgddg
enl

    Sequence, based on observed residues (ATOM records): (download) 
    >1b6qA (A:)
mtkqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarf