PDB entry 1b6p

View 1b6p on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 7
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOP 1.61 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1b6pa_
  • Chain 'B':
    Domains in SCOP 1.61: d1b6pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b6pA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b6pB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf