PDB entry 1b6p

View 1b6p on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 7
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase/peptide), hydrolase/hydrolase inhibitor complex
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369
    • see remark 999 (66)
    • see remark 999 (94)
    • see remark 999 (6)
    • see remark 999 (32)
    • see remark 999 (17)
    • see remark 999 (34)
    • see remark 999 (40)
    • see remark 999 (42)
    • see remark 999 (69)
  Domains in SCOPe 2.08: d1b6pa_
• Chain 'B':
  Compound: retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • see remark 999 (66)
    • see remark 999 (94)
    • see remark 999 (6)
    • see remark 999 (32)
    • see remark 999 (40)
    • see remark 999 (42)
    • see remark 999 (60)
  Domains in SCOPe 2.08: d1b6pb_
• Heterogens: SO4, PI7, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b6pA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b6pB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf