PDB entry 1b6l
View 1b6l on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 4
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase/peptide)
Deposited on
1999-01-17, released
2000-01-07
The last revision prior to the SCOP 1.75 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: retropepsin
Species: Human immunodeficiency virus type 1 (isolate ARV2/SF2)
Database cross-references and differences (RAF-indexed):
- Uniprot P03369
- see remark 999 (66)
- see remark 999 (94)
- see remark 999 (6)
- see remark 999 (32)
Domains in SCOP 1.75: d1b6la_ - Chain 'B':
Compound: retropepsin
Species: Human immunodeficiency virus type 1 (isolate ARV2/SF2)
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- see remark 999 (66)
- see remark 999 (94)
- see remark 999 (6)
- see remark 999 (32)
Domains in SCOP 1.75: d1b6lb_ - Heterogens: SO4, PI4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1b6lA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1b6lB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf