PDB entry 1b6l

View 1b6l on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 4
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase/peptide)
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retropepsin
    Species: Human immunodeficiency virus type 1 (isolate ARV2/SF2)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369
      • see remark 999 (66)
      • see remark 999 (94)
      • see remark 999 (6)
      • see remark 999 (32)
    Domains in SCOP 1.75: d1b6la_
  • Chain 'B':
    Compound: retropepsin
    Species: Human immunodeficiency virus type 1 (isolate ARV2/SF2)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • see remark 999 (66)
      • see remark 999 (94)
      • see remark 999 (6)
      • see remark 999 (32)
    Domains in SCOP 1.75: d1b6lb_
  • Heterogens: SO4, PI4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6lA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6lB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf