PDB entry 1b6l

View 1b6l on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 4
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOP 1.67 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1b6la_
  • Chain 'B':
    Domains in SCOP 1.67: d1b6lb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6lA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6lB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf