PDB entry 1b6k
View 1b6k on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 5
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase/peptide), hydrolase/hydrolase inhibitor complex
Deposited on
1999-01-17, released
2000-01-07
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03369
- see remark 999 (66)
- see remark 999 (94)
- see remark 999 (32)
Domains in SCOPe 2.02: d1b6ka_ - Chain 'B':
Compound: retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- see remark 999 (66)
- see remark 999 (94)
- see remark 999 (6)
- see remark 999 (32)
Domains in SCOPe 2.02: d1b6kb_ - Heterogens: SO4, PI5, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1b6kA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1b6kB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf