PDB entry 1b6k

View 1b6k on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 5
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase/peptide), hydrolase/hydrolase inhibitor complex
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369
      • see remark 999 (66)
      • see remark 999 (94)
      • see remark 999 (32)
    Domains in SCOPe 2.02: d1b6ka_
  • Chain 'B':
    Compound: retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • see remark 999 (66)
      • see remark 999 (94)
      • see remark 999 (6)
      • see remark 999 (32)
    Domains in SCOPe 2.02: d1b6kb_
  • Heterogens: SO4, PI5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6kA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6kB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf