PDB entry 1b6j

View 1b6j on RCSB PDB site
Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 1
Class: hydrolase/hydrolase inhibitor
Keywords: complex (acid proteinase-peptide), hydrolase-hydrolase inhibitor complex
Deposited on 1999-01-17, released 2000-01-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369
    • see remark 999 (66)
    • see remark 999 (94)
    • see remark 999 (40)
    • see remark 999 (42)
    • see remark 999 (44)
    • see remark 999 (69)
  Domains in SCOPe 2.08: d1b6ja_
• Chain 'B':
  Compound: retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • see remark 999 (66)
    • see remark 999 (94)
    • see remark 999 (40)
    • see remark 999 (42)
  Domains in SCOPe 2.08: d1b6jb_
• Chain 'C':
  Compound: cyclic peptide inhibitor
  Database cross-references and differences (RAF-indexed):
  • PDB 1B6J (0-End)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b6jA (A:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b6jB (B:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'C':
  No sequence available.