PDB entry 1b6i

View 1b6i on RCSB PDB site
Description: t4 lysozyme mutant with cys 54 replaced by thr, cys 97 replaced by ala, thr 21 replaced by cys and lys 124 replaced by cys (c54t,c97a,t21c,k124c)
Class: hydrolase
Keywords: hydrolase(o-glycosyl), hydrolase
Deposited on 1999-01-14, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • see remark 999 (96)
      • see remark 999 (20)
      • see remark 999 (123)
      • see remark 999 (53)
    Domains in SCOPe 2.07: d1b6ia_
  • Heterogens: HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6iA (A:)
    mnifemlrideglrlkiykdcegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqcrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6iA (A:)
    mnifemlrideglrlkiykdcegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqcrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk