PDB entry 1b6d

View 1b6d on RCSB PDB site
Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer
Class: immunoglobulin
Keywords: immunoglobulin, kappa light-chain dimer
Deposited on 1999-01-13, released 1999-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAD29608 (0-211)
      • conflict (29-30)
      • conflict (42)
      • conflict (48-49)
      • conflict (52)
      • conflict (71)
      • conflict (82)
      • conflict (92)
      • conflict (176)
    Domains in SCOPe 2.06: d1b6da1, d1b6da2
  • Chain 'B':
    Compound: immunoglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAD29608 (0-211)
      • conflict (29-30)
      • conflict (42)
      • conflict (48-49)
      • conflict (52)
      • conflict (71)
      • conflict (82)
      • conflict (92)
      • conflict (176)
    Domains in SCOPe 2.06: d1b6db1, d1b6db2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6dA (A:)
    diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
    rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6dB (B:)
    diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
    rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg