PDB entry 1b6c

View 1b6c on RCSB PDB site
Description: crystal structure of the cytoplasmic domain of the type I tgf-beta receptor in complex with fkbp12
Class: complex (isomerase/protein kinase)
Keywords: complex (isomerase/protein kinase), receptor serine/threonine kinase
Deposited on 1999-01-13, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.249
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6ca_
  • Chain 'B':
    Compound: tgf-b superfamily receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6cb_
  • Chain 'C':
    Compound: fk506-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6cc_
  • Chain 'D':
    Compound: tgf-b superfamily receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6cd_
  • Chain 'E':
    Compound: fk506-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6ce_
  • Chain 'F':
    Compound: tgf-b superfamily receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6cf_
  • Chain 'G':
    Compound: fk506-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6cg_
  • Chain 'H':
    Compound: tgf-b superfamily receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6ch_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6cA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b6cB (B:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6cB (B:)
    ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
    ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
    ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
    avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
    csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
    wyangaarltalrikktlsqlsqqeg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6cC (C:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b6cD (D:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6cD (D:)
    ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
    ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
    ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
    avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
    csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
    wyangaarltalrikktlsqlsqqeg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6cE (E:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b6cF (F:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6cF (F:)
    ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
    ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
    ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
    avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
    csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
    wyangaarltalrikktlsqlsqqeg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6cG (G:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1b6cH (H:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6cH (H:)
    ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
    ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
    ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
    avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
    csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
    wyangaarltalrikktlsqlsqqeg