PDB entry 1b6b

View 1b6b on RCSB PDB site
Description: melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism
Deposited on 1999-01-13, released 2000-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1b6ba_
  • Chain 'B':
    Domains in SCOP 1.63: d1b6bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b6bA (A:)
    anefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegrlvaf
    iigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpav
    rravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b6bB (B:)
    nefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegrlvafi
    igslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpavr
    ravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6bB (B:)
    nefrcltpedaagvfeiereafdevqhfltlcpelslgwfvegrlvafiigslwdeerlt
    qeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalv
    pfyqrfgfhpagpcaivvgsltftemhcslrghaal