PDB entry 1b6a

View 1b6a on RCSB PDB site
Description: human methionine aminopeptidase 2 complexed with tnp-470
Class: angiogenesis inhibitor
Keywords: angiogenesis inhibitor, aminopeptidase
Deposited on 1999-01-13, released 2000-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6aa1, d1b6aa2
  • Heterogens: CO, TN4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6aA (A:)
    magveevaasgshlngdldpddreegaastaeeaakkkrrkkkkskgpsaageqepdkes
    gasvdevarqlersaledkerdeddedgdgdgdgatgkkkkkkkkkrgpkvqtdppsvpi
    cdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndfreaaeahrqvr
    kyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdtt
    vlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdv
    geaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkggeatrmeegev
    yaietfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwl
    drlgeskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6aA (A:)
    kvqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyv
    mswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlq
    yddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgea
    iqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkggeatrmeegevyai
    etfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrl
    geskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy