PDB entry 1b69

View 1b69 on RCSB PDB site
Description: the solution structure of tn916 integrase n-terminal domain/dna complex
Deposited on 1999-01-21, released 1999-09-29
The last revision prior to the SCOP 1.59 freeze date was dated 1999-10-28, with a file datestamp of 1999-10-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1b69a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b69A (A:)
  ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdaislre
  kiaelqkdi