PDB entry 1b69

View 1b69 on RCSB PDB site
Description: the solution structure of tn916 integrase n-terminal domain/DNA complex
Class: integrase/DNA
Keywords: integrase, DNA binding, transposition, complex, beta-sheet recognition, integrase-DNA complex
Deposited on 1999-01-21, released 1999-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (integrase)
  Species: Enterococcus faecalis [TaxId:1351]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22886 (0-68)
    • engineered mutation (54)
  Domains in SCOPe 2.08: d1b69a_
• Chain 'B':
  Compound: DNA (5'-d(*gp*ap*gp*tp*ap*gp*tp*ap*ap*ap*tp*tp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'C':
  Compound: DNA (5'-d(*gp*ap*ap*tp*tp*tp*ap*cp*tp*ap*cp*tp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b69A (A:)
  ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdaislre
  kiaelqkdi
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.