PDB entry 1b68

View 1b68 on RCSB PDB site
Description: apolipoprotein e4 (apoe4), 22k fragment
Class: lipid transport
Keywords: lipid transport, heparin-binding, plasma protein, hdl, vldl
Deposited on 1999-01-21, released 2001-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b68a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b68A (A:)
    kveqavetepepelrqqtewqsgqrwelalgrfwdylrwvqtlseqvqeellssqvtqel
    ralmdetmkelkaykseleeqltpvaeetrarlskelqaaqarlgadmedvrgrlvqyrg
    evqamlgqsteelrvrlashlrklrkrllrdaddlqkrlavyqagaregaerglsairer
    lgplveqgrvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b68A (A:)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
    taeetrarlskelqaaqarlgadmedvrgrlvqyrgevqamlgqsteelrvrlashlrkl
    rkrllrdaddlqkrlavy