PDB entry 1b64

View 1b64 on RCSB PDB site
Description: solution structure of the guanine nucleotide exchange factor domain from human elongation factor-one beta, nmr, 20 structures
Class: guanine nucleotide exchange factor
Keywords: guanine nucleotide exchange factor, g-protein, translation elongation
Deposited on 1999-01-20, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor 1-beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b64a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b64A (A:)
    mlvakssilldvkpwddetdmakleecvrsiqadglvwgssklvpvgygikklqiqcvve
    ddkvgtdmleeqitafedyvqsmdvaafnki