PDB entry 1b63

View 1b63 on RCSB PDB site
Description: mutl complexed with adpnp
Class: DNA mismatch repair
Keywords: DNA mismatch repair, ATPase
Deposited on 1999-01-20, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mutl
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: MUTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b63a1, d1b63a2, d1b63a3
  • Heterogens: MG, EDO, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b63A (A:)
    shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
    ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
    eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
    alarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrg
    wvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphq
    vdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq