PDB entry 1b5v

View 1b5v on RCSB PDB site
Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants
Class: hydrolase
Keywords: hydrogen bond, stability, hydrolase
Deposited on 1999-01-11, released 1999-01-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.161
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (lysozyme)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • engineered (50)
  Domains in SCOPe 2.04: d1b5va_
• Heterogens: NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b5vA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdratdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv