PDB entry 1b5q

View 1b5q on RCSB PDB site
Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
Class: oxidoreductase
Keywords: flavin-dependent amine oxidase, oxidoreductase
Deposited on 1999-01-07, released 2000-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (polyamine oxidase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • GB CAA05249
    Domains in SCOPe 2.07: d1b5qa1, d1b5qa2
  • Chain 'B':
    Compound: protein (polyamine oxidase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • GB CAA05249
    Domains in SCOPe 2.07: d1b5qb1, d1b5qb2
  • Chain 'C':
    Compound: protein (polyamine oxidase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • GB CAA05249
    Domains in SCOPe 2.07: d1b5qc1, d1b5qc2
  • Heterogens: NAG, FAD, MD2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b5qA (A:)
    atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
    vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
    emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
    qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
    kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
    iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
    sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
    pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b5qA (A:)
    prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
    nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
    klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
    platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
    ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytkiflk
    fprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeq
    tkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlrapvgr
    vyftgehtsehyngyvhgaylsgidsaeilincaqkkmc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b5qB (B:)
    atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
    vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
    emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
    qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
    kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
    iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
    sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
    pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b5qB (B:)
    prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
    nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
    klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
    platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
    ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytkiflk
    fprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeq
    tkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlrapvgr
    vyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b5qC (C:)
    atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
    vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
    emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
    qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
    kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
    iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
    sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
    pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b5qC (C:)
    prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
    nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
    klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
    platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
    ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytkiflk
    fprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeq
    tkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlrapvgr
    vyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh