PDB entry 1b5m

View 1b5m on RCSB PDB site
Description: rat outer mitochondrial membrane cytochrome b5
Class: electron transport
Keywords: cytochrome, electron transport, heme
Deposited on 1996-11-07, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04166 (0-83)
  Domains in SCOPe 2.08: d1b5ma_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b5mA (A:)
  avtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfedvg
  hspdaremlkqyyigdvhpndlkp