PDB entry 1b5f

View 1b5f on RCSB PDB site
Description: native cardosin a from cynara cardunculus l.
Class: hydrolase
Keywords: hydrolase, aspartic proteinase
Deposited on 1999-01-06, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cardosin a)
    Species: Cynara cardunculus [TaxId:4265]
    Database cross-references and differences (RAF-indexed):
    • EMBL AJ132884 (0-238)
    Domains in SCOPe 2.07: d1b5f.1
  • Chain 'B':
    Compound: protein (cardosin a)
    Species: Cynara cardunculus [TaxId:4265]
    Database cross-references and differences (RAF-indexed):
    • EMBL AJ132884 (0-86)
    Domains in SCOPe 2.07: d1b5f.1
  • Chain 'C':
    Compound: protein (cardosin a)
    Species: Cynara cardunculus [TaxId:4265]
    Database cross-references and differences (RAF-indexed):
    • EMBL AJ132884 (Start-238)
    Domains in SCOPe 2.07: d1b5f.2
  • Chain 'D':
    Compound: protein (cardosin a)
    Species: Cynara cardunculus [TaxId:4265]
    Database cross-references and differences (RAF-indexed):
    • EMBL AJ132884 (0-86)
    Domains in SCOPe 2.07: d1b5f.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5fA (A:)
    gsavvaltndrdtsyfgeigigtppqkftvifdtgssvlwvpsskcinskacrahsmyes
    sdsstykengtfgaiiygtgsitgffsqdsvtigdlvvkeqdfieatdeadnvflhrlfd
    gilglsfqtisvpvwynmlnqglvkerrfsfwlnrnvdeeeggelvfggldpnhfrgdht
    yvpvtyqyywqfgigdvligdkstgfcapgcqafadsgtsllsgptaivtqinhaigan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5fB (B:)
    eelqvdcntlssmpnvsftiggkkfgltpeqyilkvgkgeatqcisgftamdatllgplw
    ilgdvfmrpyhtvfdygnllvgfaeaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b5fC (C:)
    gsavvaltndrdtsyfgeigigtppqkftvifdtgssvlwvpsskcinskacrahsmyes
    sdsstykengtfgaiiygtgsitgffsqdsvtigdlvvkeqdfieatdeadnvflhrlfd
    gilglsfqtisvpvwynmlnqglvkerrfsfwlnrnvdeeeggelvfggldpnhfrgdht
    yvpvtyqyywqfgigdvligdkstgfcapgcqafadsgtsllsgptaivtqinhaigan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b5fC (C:)
    savvaltndrdtsyfgeigigtppqkftvifdtgssvlwvpsskcinskacrahsmyess
    dsstykengtfgaiiygtgsitgffsqdsvtigdlvvkeqdfieatdeadnvflhrlfdg
    ilglsfqtisvpvwynmlnqglvkerrfsfwlnrnvdeeeggelvfggldpnhfrgdhty
    vpvtyqyywqfgigdvligdkstgfcapgcqafadsgtsllsgptaivtqinhaigan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5fD (D:)
    eelqvdcntlssmpnvsftiggkkfgltpeqyilkvgkgeatqcisgftamdatllgplw
    ilgdvfmrpyhtvfdygnllvgfaeaa