PDB entry 1b5d

View 1b5d on RCSB PDB site
Description: DCMP Hydroxymethylase from T4 (Intact)
Class: transferase
Keywords: hydroxymethylase, dNTP synthesizing complex, transferase
Deposited on 1999-01-06, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (deoxycytidylate hydroxymethylase)
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b5da_
  • Chain 'B':
    Compound: protein (deoxycytidylate hydroxymethylase)
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b5db_
  • Heterogens: DCM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5dA (A:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    yvgkya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5dB (B:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    yvgkya