PDB entry 1b5c

View 1b5c on RCSB PDB site
Description: the structure of cytochrome $b=5= at 2.0 angstroms resolution
Deposited on 1972-08-10, released 1972-08-10
The last revision was dated 1972-08-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1b5c_ (-)
    skavkyytleqiekhnnskstwlilhykvydltkfleehpggeevlreqaggdatedfed
    vghstdarelsktfiigelhpddrskitkpses
    

    Sequence, based on observed residues (ATOM records):
    >1b5c_ (-)
    avkyytleqiekhnnskstwlilhykvydltkfleehpggeevlreqaggdatedfedvg
    hstdarelsktfiigelhpddrski
    

  • Chain 'p':
    No sequence available.