PDB entry 1b5b

View 1b5b on RCSB PDB site
Description: rat ferrocytochrome b5 b conformation, nmr, 1 structure
Class: electron transport
Keywords: electron transport
Deposited on 1998-04-06, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferrocytochrome b5
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b5ba_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5bA (A:)
    dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktyiigelhpddrskiakpsetl