PDB entry 1b5a

View 1b5a on RCSB PDB site
Description: rat ferrocytochrome b5 a conformation, nmr, 1 structure
Deposited on 1998-04-06, released 1998-06-17
The last revision prior to the SCOP 1.67 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1b5a__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b5a_ (-)
    dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktyiigelhpddrskiakpsetl