PDB entry 1b5a

View 1b5a on RCSB PDB site
Description: rat ferrocytochrome b5 a conformation, nmr, 1 structure
Class: electron transport
Keywords: electron transport
Deposited on 1998-04-06, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferrocytochrome b5
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00173 (0-93)
  Domains in SCOPe 2.08: d1b5aa_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b5aA (A:)
  dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
  vghstdarelsktyiigelhpddrskiakpsetl